Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_6112 |
| Peptide Name | EXTN2_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Cell wall; Cell wall biogenesis/degradation; Complete proteome; Glycoprotein; Hydroxylation; Repeat; Secreted; Signal; Structural protein | Extensin-2 precursor (AtExt2) (Cell wall hydroxyproline-rich,glycoprotein 1) (HRGP1).Secreted, primary cell wall. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | MGPSAHLISALGVIIMATMVAAYEPETYASPPPLYSSPLPEVEYKTPPLPVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSPKTEY |
| Sequence Length | 743 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 83015.06 |
| Monoisotopic Molecular Weight (Da) | 82961.67 |
| Isoelectric Point (pI) | 9.28 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q9M1G9 |
| NCBI | --NA-- |
| EMBL | AB022782 |
| Link to Source Databases | SPdb78211 |
|---|
| Addtional Information | FUNCTION:Structural component which strengthens the primary cell wall.TISSUE SPECIFICITY:Predominantly expressed in the roots.DEVELOPMENTAL STAGE:Early expressed in the whole plant, but was restricted to lower stems, flower buds and roots in the mature plant (6 weeks old).INDUCTION:By wounding and water stress; in response to plant hormones 2,4-D, BAP treatment; in response to L-Pro treatment.Repressed by salt stress.PTM:Extensins contain a characteristic repeat of the pentapeptide Ser-Pro(4).The proline residues are hydroxylated and then O- glycosylated (arabinosylation).PTM:Synthetised as soluble proteins which become insolubilised in the cell wall through the intermolecular cross-linking of Tyr on adjacent monomers. Isodityrosine (IDT) stabilizes and makes rigid the part of the polypeptide where IDT functional sites are present.SIMILARITY:Belongs to the extensin family.SEQUENCE CAUTION:Sequence=BAB21544.1; Type=Frameshift; Positions=17; Sequence=BAB21544.1; Type=Miscellaneous discrepancy; Note=Incomplete cDNA clone; |
