Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_6087 |
| Peptide Name | NLTP_PINTA |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Pinus taeda |
| Plant Source (Common Name) | Loblolly pine |
| Plant Family | Pinaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Lipid-binding; Signal; Transport | Non-specific lipid-transfer protein precursor (LTP). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | MAVKKMVEAVFVVGLVVTMMNVWGAVPVEGAISCNQVVSAMTPCATYLIGNAATPAATCCPSIRGLDSQVKATPDRQAVCNCLKTQAKSYGVKLGKAANLPGLCKVTDLNVPISPNVDCSKVH |
| Sequence Length | 123 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 12751.1 |
| Monoisotopic Molecular Weight (Da) | 12742.47 |
| Isoelectric Point (pI) | 8.85 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q41073 |
| NCBI | --NA-- |
| EMBL | U10432 |
| Link to Source Databases | SPdb170446 |
|---|
| Addtional Information | FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.SIMILARITY:Belongs to the plant LTP family. |
