Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_6079 |
| Peptide Name | ZEA9_MAIZE |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Zea mays |
| Plant Source (Common Name) | Maize |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Repeat; Seed storage protein; Signal; Storage protein | Zein-alpha 19C2 precursor (19 kDa zein 19C2). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | MATKIFSLLMLLALSTCVANATIFPQCSQAPIASLLPPYLPSIIASICENPALQPYRLQQAIAASNIPLSPLLFQQSPALSLVQSLVQTIRAQQLQQLVLPLINQVALANLSPYSQQQQFLPFNQLSTLNPAAYLQQQLLPFSQLATAYSQFAANPATLLQLQQLLPFVQLALTDPAASYQQHIIGGALFQQQQLLPFNQLAALNPAAYLQQQILLPFSQLAAANRASFLTQQQLLPFYQ |
| Sequence Length | 240 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 26280.67 |
| Monoisotopic Molecular Weight (Da) | 26264.07 |
| Isoelectric Point (pI) | 8.52 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P06677 |
| NCBI | --NA-- |
| EMBL | M12145 |
| Link to Source Databases | SPdb354613 |
| Addtional Information | FUNCTION:Zeins are major seed storage proteins.MISCELLANEOUS:The alpha zeins of 19 kDa and 22 kDa account for 70% of the total zein fraction. They are encoded by a large multigene family.MISCELLANEOUS:Structurally, 22K and 19K zeins are composed of nine adjacent, topologically antiparallel helices clustered within a distorted cylinder.SIMILARITY:Belongs to the zein family. |