Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_6074 |
| Peptide Name | ALB1F_PEA |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Pisum sativum |
| Plant Source (Common Name) | Garden pea |
| Plant Family | Fabaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Direct protein sequencing; Knottin; Plant toxin; Seed storage protein; Signal; Storage protein; Toxin | Albumin-1 F precursor (PA1 F) (PsaA1b005/PsaA1b011) [Contains:,Albumin-1 F chain b (PA1b F) (Leginsulin F); Albumin-1 F chain a (PA1a,F)]. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | MASVKLASLIVLFATLGMFLTKNVGAASCNGVCSPFEMPPCGTSACRCIPVGLVIGYCRNPSGVFLRTNDEHPNLCESDADCRKKGSGKFCGHYPNPGIEYGWCFASKSEAEDFFSKITQKDLLKSVSTA |
| Sequence Length | 130 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 13913.07 |
| Monoisotopic Molecular Weight (Da) | 13903.69 |
| Isoelectric Point (pI) | 8.03 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P62931 |
| NCBI | --NA-- |
| EMBL | AJ574793 |
| Link to Source Databases | SPdb7219 |
| Addtional Information | FUNCTION:PA1b binds to basic 7S globulin (BG) and stimulates its phosphorylation activity. Involved in the signal transduction system to regulate the growth and differentiation as a hormone peptide (By similarity). Toxic to various insects through binding to a high affinity binding site in the insect gut.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.PTM:The C-terminal glycine may be removed from PA1b. |