Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_6057 |
| Peptide Name | NO12_VICSA |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Vicia sativa |
| Plant Source (Common Name) | Spring vetch |
| Plant Family | Fabaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Cell wall; Nodulation; Repeat; Secreted; Signal | Early nodulin 12 precursor (N-12).Secreted, cell wall (Potential). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | MASFLLSTLVFFLAALILVPQGLAQYHLNPVYEAPVNGPPVNKPPQKETPVQKPPQKEPPVHKSPRNEPPRHKPPHKKSHLHVTKRSYGKHATEEHSIHF |
| Sequence Length | 100 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 11297.09 |
| Monoisotopic Molecular Weight (Da) | 11290.06 |
| Isoelectric Point (pI) | 9.93 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q41701 |
| NCBI | --NA-- |
| EMBL | X83682 |
| Link to Source Databases | SPdb170631 |
|---|
| Addtional Information | FUNCTION:Involved in the infection process during the plant- rhizobium interaction. May also have an additional function in the proliferation of the bacteria.DEVELOPMENTAL STAGE:Expressed during rhizobium-induced nodule formation. In 4-day old nodules it is found in all the cells of the center of the nodule primordium and also occurs in the root cortical cells containing the infection thread. At day 5, expression is seen in the complete central tissue and at day 20, expressed in the complete prefixation zone II and is present at a similar level throughout the zone. In the distal part of the prefixation zone II it is probably expressed in all cells, whereas in the proximal part, found only in the infected cells. Expression decreases at the transition of prefixation zone II into interzone II-III.SIMILARITY:Belongs to the ENOD12 family. |
