Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_5947 |
| Peptide Name | THNB_WHEAT |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Triticum aestivum |
| Plant Source (Common Name) | Wheat |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Direct protein sequencing; Plant defense; Plant toxin; Secreted; Signal; Toxin | Purothionin A-1 precursor (Purothionin A-I) (Beta-purothionin),[Contains: Purothionin A-1; Acidic protein].Secreted. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | LCANVCRCKLTSGLSCPKDFPKLVLESNSDEPDTMEYCNLGCRSSLCDYIMGSKGLKGVMVCLLILGLVLEQVQVEGKSCCKSTLGRNCYNLCRARGAQKVNAAADDEEMKLYVEQCGDACVNFCNADAGLTSLDA |
| Sequence Length | 136 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 14624.93 |
| Monoisotopic Molecular Weight (Da) | 14614.86 |
| Isoelectric Point (pI) | 4.94 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P01543 |
| NCBI | --NA-- |
| EMBL | AF004018 |
| Link to Source Databases | SPdb293640 |
| Addtional Information | FUNCTION:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.SIMILARITY:Belongs to the plant thionin (TC 1.C.44) family. |