Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5853 |
| Peptide Name | PUIB_WHEAT |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Triticum aestivum |
| Plant Source (Common Name) | Wheat |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Antibiotic; Antimicrobial; Direct protein sequencing; Membrane; Plant defense; Polymorphism; Secreted; Signal; Toxin | Puroindoline-B precursor.Membrane. Secreted, extracellular space. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | IRRVIQGRLGGFLGIWRGEVFKQLQRAQSLPSKCNMGADCKFPSGYYWKDYVMERCFTMKDFPVTWPTKWWKGGCEHEVREKCCKQLSQIAPQCRCDSMKTLFLLALLALVASTTFAQYSEVGGWYNEVGGGGGSQQCPQERPKLSSC |
| Sequence Length | 148 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 16792.46 |
| Monoisotopic Molecular Weight (Da) | 16781.2 |
| Isoelectric Point (pI) | 9.06 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q10464 |
| NCBI | --NA-- |
| EMBL | X69912 |
| Link to Source Databases | SPdb205134 |
|---|
| Addtional Information | FUNCTION:Acts as a membranotoxin, probably through its antibacterial and antifungal activities, contributing to the defense mechanism of the plant against predators. Forms monovalent cation-selective ion channels in membranes. Has antibacterial activity against the Gram-positive bacteria S.aureus and C.michiganensis, and the Gram-negative bacteria E.coli, P.syringae pv phaseoli, A.tumefaciens and E.carotovora subsp carotovora. Acts synergistically with PINA against bacteria. Contributes to grain texture and hardness.TISSUE SPECIFICITY:Endosperm and aleurone layer of developing kernels. In the aleurone layer, mainly localized to starch granules and the surface of the plasma membrane, forming a uniform layer, also abundant in the intercellular space. In the endosperm, mainly localized to starch granules and the plasma membrane, but less abundant in the intercellular space. Not found in roots or coleoptiles.DEVELOPMENTAL STAGE:Starts to accumulate in seeds between 8 and 12 days after flowering. Levels increase markedly between 15 and 18 days after flowering, reaching a peak between 26 and 33 days after flowering. Levels then decline rapidly at none is detected at 40 days after flowering. Not detected in germinated seeds.PTM:Five disulfide bonds are present.MASS SPECTROMETRY:Mass=13076; Method=Electrospray; Range=30-148; Note=In cv. Riband; Source=PubMed:17076702;MASS SPECTROMETRY:Mass=13076; Method=MALDI; Range=30-148; Note=In cv. Consort; Source=PubMed:17076702;MASS SPECTROMETRY:Mass=13103; Method=Electrospray; Range=30-148; Note=In cv. Hereward; Source=PubMed:17076702;MASS SPECTROMETRY:Mass=13106; Method=MALDI; Range=30-148; Note=In cv. Hereward; Source=PubMed:17076702;MASS SPECTROMETRY:Mass=13045; Method=Electrospray; Range=30-148; Note=In cv. Soissons; Source=PubMed:17076702;POLYMORPHISM:Variation in, or absence of, PINB is associated with variation in grain texture. |
