Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_5772 |
| Peptide Name | EXPB9_MAIZE |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Zea mays |
| Plant Source (Common Name) | Maize |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Allergen; Cell wall; Cell wall biogenesis/degradation; Direct protein sequencing; Glycoprotein; Membrane; Secreted; Signal | Expansin-B9 precursor (ZmEXPB9) (Beta-expansin-1b) (Pollen allergen,Zea m 1).Secreted, cell wall; Peripheral membrane protein (By similarity). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | HCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDIVLIIPANWRPDAVYTSNVQFYMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDMGSLANNIMVVGAVLAALVVGGSCGPPKVPPGPNITTNYNGKWLTARATWRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKLRYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEV |
| Sequence Length | 269 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 29080.69 |
| Monoisotopic Molecular Weight (Da) | 29061.61 |
| Isoelectric Point (pI) | 9.01 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | Q07154 |
| NCBI | --NA-- |
| EMBL | L14271 |
| Link to Source Databases | SPdb78169 |
| Addtional Information | FUNCTION:May aid fertilization by loosening the cell wall of the stigma and style, thereby facilitating penetration of the pollen tube. Acts selectively on grass cell walls, which are relatively poor in pectins and xyloglucans and rich in glucuronoarabinoxylans and (1-3),(1-4)-beta-D-glucans, when compared with cell walls of other angiosperms, including other monocots.TISSUE SPECIFICITY:Expressed in anthers and pollen.DEVELOPMENTAL STAGE:Expression low before and high after pollen mitosis.ALLERGEN:Causes an allergic reaction in human. Causes maize pollen allergy.SIMILARITY:Belongs to the expansin family. Expansin B subfamily.SIMILARITY:Contains 1 expansin-like CBD domain.SIMILARITY:Contains 1 expansin-like EG45 domain. |