Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_5742 |
| Peptide Name | GLTB_WHEAT |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Triticum aestivum |
| Plant Source (Common Name) | Wheat |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Repeat; Seed storage protein; Signal; Storage protein | Glutenin, low molecular weight subunit 1D1 precursor. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | GTGVGAYIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAMKTFLVFALLAVAATSAIAQMETRCIPGLERPWQQQPLPPQQTFPQQPLFPQQPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPVVQPSILQQLNPCQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGVSQQQQQQLFPQQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVL |
| Sequence Length | 307 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 34927.89 |
| Monoisotopic Molecular Weight (Da) | 34905.66 |
| Isoelectric Point (pI) | 8.91 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P10386 |
| NCBI | --NA-- |
| EMBL | X13306 |
| Link to Source Databases | SPdb99003 |
| Addtional Information | FUNCTION:Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.SUBUNIT:Disulfide-bridge linked aggregates.TISSUE SPECIFICITY:Expressed in endosperm, but not in husk and leaf tissues.MISCELLANEOUS:Glutenins are coded by several genes on each of the group 1 chromosomes of wheat.SIMILARITY:Belongs to the gliadin/glutenin family. |