Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_5728
Peptide Name	EXPB3_ARATH
PMID(s)	--NA--
Plant Source (Scientific Name)	Arabidopsis thaliana
Plant Source (Common Name)	Mouse-ear cress
Plant Family	Brassicaceae
Peptide Family	--NA--
Peptide Function	Signaling-peptide
Peptide Function Description	Cell wall; Cell wall biogenesis/degradation; Complete proteome; Membrane; Secreted; Signal | Expansin-B3 precursor (AtEXPB3) (At-EXPB3) (Beta-expansin-3) (Ath-,ExpBeta-1.6).Secreted, cell wall; Peripheral membrane protein.
Activity Against	--NA--
IC50 value	--NA--
Sequence	GSDGGACGYGTLVDVKPLHARVGAVNPILFKNGEGCGACYKVRCLDKSICIYRRTACKYRGKNIAFHVNEGSTDFWLSLLVEFEDGEGDIGSMHIRQAGAKATYSSRLNFSPVLMQLFPVMLATLCIVLQLLIGSSALATTNRHVSNSHWLPAVATWYGSPNGDREWLEMKHVWGANWCIIGGPLKGPFSIKLTTLSAGKTLSATDVVPRNWAPSRRAVTVIITDECPGCSKTSTHFDLSGAVFGRLAIAGESGPLRNRGLIPV
Sequence Length	264
Validation	Experimental evidence at transcript level
Average Molecular Weight (Da)	28424.79
Monoisotopic Molecular Weight (Da)	28406.49
Isoelectric Point (pI)	9.04
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_5728

External links (Uniprot, PDB and Source Information Database)
Uniprot	Q9M0I2
NCBI	--NA--
EMBL	AL161572
Link to Source Databases	SPdb78160
Addtional Information	FUNCTION:May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found (By similarity).SIMILARITY:Belongs to the expansin family. Expansin B subfamily.SIMILARITY:Contains 1 expansin-like CBD domain.SIMILARITY:Contains 1 expansin-like EG45 domain.SEQUENCE CAUTION:Sequence=CAB79627.1; Type=Erroneous gene model prediction;