Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5642 |
| Peptide Name | SPI1_SOLTU |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Solanum tuberosum |
| Plant Source (Common Name) | Potato |
| Plant Family | Solanaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Direct protein sequencing; Protease inhibitor; Serine protease inhibitor; Signal; Vacuole | Serine protease inhibitor 1 precursor (PSPI-21) (PSPI-21-6.3),[Contains: Serine protease inhibitor 1 chain A; Serine protease,inhibitor 1 chain B].Vacuole (By similarity). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | GKRRLALVKDNPLDISFKQVQIGQADSSWFKIVKSSQLGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNMKCLFLVCLCLVPIVVFSSTFTSQNPINLPSDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGT |
| Sequence Length | 221 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 24009.5 |
| Monoisotopic Molecular Weight (Da) | 23994.03 |
| Isoelectric Point (pI) | 6.87 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P58514 |
| NCBI | --NA-- |
| EMBL | AF495585 |
| Link to Source Databases | SPdb274442 |
|---|
| Addtional Information | FUNCTION:Potent inhibitor of serine proteases (chymotrypsin and trypsin). Inhibits tightly human leukocyte elastase (HLE). Does not inhibit papain, pepsin nor cathepsin D (cysteine and aspartic proteases). Protects the plant by inhibiting proteases of invading organisms, decreasing both hyphal growth and zoospores germination of Phytophthora infestans.SUBUNIT:Heterodimer of chains A and B; disulfide-linked. Double- headed inhibitor able to form triple complexes with target proteases, by binding simultaneously one molecule of trypsin and one molecule of chymotrypsin.TISSUE SPECIFICITY:Tubers.INDUCTION:By infection with Phytophthora infestans.PTM:Synthesized as a single-chain precursor which is cleaved to form chain A and chain B.MASS SPECTROMETRY:Mass=20262; Mass_error=20; Method=Electrospray; Range=29-178, 185-221; Note=The measured mass is that of the native protein composed of the 2 chains A and B; Source=PubMed:11209756;MASS SPECTROMETRY:Mass=16078; Mass_error=16; Method=Electrospray; Range=29-178; Source=PubMed:11209756;MASS SPECTROMETRY:Mass=4282; Mass_error=4; Method=Electrospray; Range=185-221; Source=PubMed:11209756;MISCELLANEOUS:The serine protease inhibitor PSPI-21 comprises two protein species with pI 5.2 and 6.3, denoted as PSPI-21-5.2 and PSPI-21-6.3. They may be encoded by two alleles at the same gene locus.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family. |
