Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5587 |
| Peptide Name | CLH0_CHEAL |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Chenopodium album |
| Plant Source (Common Name) | Lamb's-quarters |
| Plant Family | Amaranthaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Chlorophyll catabolism; Direct protein sequencing; Glycoprotein; Hydrolase; Signal | Chlorophyllase type 0 precursor (EC 3.1.1.14) (CaCLH0) (Chlorophyll-,chlorophyllido hydrolase 0) (Chlase 0). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | GDLEKLAISGHSRGGKSAFALALGFSNIKLDVTFSALIGVDPVAGRSVDDGFIVVAPKLFRLFPPKLPSQQDEIDMAASVANWMPLYLQVVLQRYVTGVEMAKLLLLIFGVFIFVNSQAQTFPTILEKHNSEKITDVFHKGNFQVTNNPINSSHFVITKYGHMDMLNEFRLSPIAVTMSLMCAQSFRPKATMRRTLGGIMRTLPHVLTYKPNSFNLSIPVTVIGSGLGNHTISCAPNHVSHQQFYDECKERVKRYEFSAPEPLIIISPKEAGVYPVLLFIHGTMLSNEDYSLFFNYIASHVAFLNAYFRDDGRQYYAIIANRSLAPTNLFAEKKGFNFGFATTYAQL |
| Sequence Length | 347 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 38706.77 |
| Monoisotopic Molecular Weight (Da) | 38681.96 |
| Isoelectric Point (pI) | 8.97 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q9LE89 |
| NCBI | --NA-- |
| EMBL | AB025025 |
| Link to Source Databases | SPdb40104 |
|---|
| Addtional Information | FUNCTION:Catalyzes the hydrolysis of ester bond in chlorophyll to yield chlorophyllide and phytol.CATALYTIC ACTIVITY:Chlorophyll H(2)O = phytol chlorophyllide.ENZYME REGULATION:Inhibited by diisopropyl fluorophosphate (DFP), phenylmethanesulfonyl fluoride (PMSF) or p-chloromercuribenzoic acid (PCMB), but not by N-ethylmaleimide (NEM) or iodoacetamide.PATHWAY:Porphyrin metabolism; chlorophyll degradation.MISCELLANEOUS:It has been proposed that CaCLH0 is transported to vacuole via the endoplasmic reticulum where it might be glycosylated.SIMILARITY:Belongs to the AB hydrolase superfamily. Lipase family. |
