Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5466 |
| Peptide Name | CKX6_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Complete proteome; FAD; Flavoprotein; Glycoprotein; Oxidoreductase; Secreted; Signal | Cytokinin dehydrogenase 6 precursor (EC 1.5.99.12) (Cytokinin oxidase,6) (CKO6) (AtCKX6) (AtCKX7).Secreted, extracellular space (By similarity). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | FDYIEGFVIINRTGLLNSWRLSFTAEEPLEASQFKFDGRTLYCLELAKYLFGNRYQLIPLAVLHPKSVSDIASTIRHIWMMGTHSQLTVAARGRGHSLQGGLAPKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEIVTGKGEIGQWEVPHPWLNLLVPRSKINEFARGVFGNILTDTSNGPVIVYPVNKSKWDIGLKQYLPHYTTREEWRSHFGDKWGEFVRRKSRYDPLAILAPGHRIFQKAKQDNKDVINQEVKETLSELSYVTSTLFTTEVAYEAFLDRVHVSEVKLRSKLNCTKRQNSDLFNGVLGGLGQFGIITRARIALEPAPTMDQEQLISAQGHKMLIVRSFTILLLSCIAFKLACCFSSSISSLKALPLVGHLEFEHVHHASKDNQTSAVTPEEEVFYLVAILTSASPGSAGKDGVEEILRRNRRILEFSEEAGQAQTRHGIVIHMESLHPQKLQVYSVDSPAPYVDVSGGELWINILHETLKYVSYS |
| Sequence Length | 504 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 56519.57 |
| Monoisotopic Molecular Weight (Da) | 56484.33 |
| Isoelectric Point (pI) | 8.19 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q9LY71 |
| NCBI | --NA-- |
| EMBL | AL163818 |
| Link to Source Databases | SPdb39616 |
|---|
| Addtional Information | FUNCTION:Catalyzes the oxidation of cytokinins, a family of N(6)- substituted adenine derivatives that are plant hormones, where the substituent is an isopentenyl group (By similarity).CATALYTIC ACTIVITY:N(6)-dimethylallyladenine acceptor H(2)O = adenine 3-methylbut-2-enal reduced acceptor.COFACTOR:FAD (By similarity).TISSUE SPECIFICITY:Expressed in the vascular system of roots, of young growing leaves and of the most apical portion of the growing stem. No expression in the root apical meristem. In flowers, restricted to the vascular bundles and transmitting tissue of developing gynoeciae.DEVELOPMENTAL STAGE:Expressed during the maturation phase of stomatal guard cells but not in fully mature stomata. In the root vasculature, detected soon after germination, with a maxima around the lateral root primordia.SIMILARITY:Belongs to the oxygen-dependent FAD-linked oxidoreductase family. |
