Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_5451 |
| Peptide Name | LEC1_DOLBI |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Dolichos biflorus |
| Plant Source (Common Name) | Horse gram |
| Plant Family | Fabaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Calcium; Glycoprotein; Lectin; Signal | Seed lectin subunit I precursor (SL) [Contains: Seed lectin subunit,II]. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | FASKLPDDSTAEPLDLASYLVRNVLLQLTKVKENGIPTPSSLGRAFYSSPIQIYDKSTGAVASWATSFTVKISAPLVHPSRRTSYILSERVDITNELPEYVSVGFSATTGLSEGYIETHDVLSWSMASSTVSVVLSLFLLLLTQANSANIQSFSFKNFNSPSFILQGDATVSSGKNSGWDPSMKHIGIDVNSIKSIATVSWDLANGENAEILITYNAATSLLVASSKASFADGIAFALVPVGSEPRRNGGYLGVFDSDVYNNSAQTVAVEFDTFS |
| Sequence Length | 275 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 29405.94 |
| Monoisotopic Molecular Weight (Da) | 29387.9 |
| Isoelectric Point (pI) | 4.84 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P05045 |
| NCBI | --NA-- |
| EMBL | J02721 |
| Link to Source Databases | SPdb137500 |
| Addtional Information | FUNCTION:Metalloglycoprotein, containing Ca, Mg, Mn, and Zn and the carbohydrates galactose, glucosamine, mannose, and fucose. It agglutinates erythrocytes of blood group A1. Has a high preference for GalNAc over Gal.SUBUNIT:Homotetramer.PTM:Subunit II may arise from subunit I by proteolytic cleavage at the C-terminal end.SIMILARITY:Belongs to the leguminous lectin family. |