Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5427 |
| Peptide Name | E132_SOLTU |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Solanum tuberosum |
| Plant Source (Common Name) | Potato |
| Plant Family | Solanaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Glycoprotein; Glycosidase; Hydrolase; Pyrrolidone carboxylic acid; Signal; Vacuole | Glucan endo-1,3-beta-glucosidase, basic isoform 2 precursor,(EC 3.2.1.39) ((1->3)-beta-glucan endohydrolase) ((1->3)-beta-,glucanase) (Beta-1,3-endoglucanase).Vacuole (By similarity). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | ETNSTASSLISEMGNDIKVSTSVDMTLIGNSYPPSQGSFRNDVRWFTDPIVGFLRDTRAPLLVGPIETYIFAMFDENNKNPELEKHFGLFSPNKQPKYNLNFGVSERVWDISAKNVKDFWPDVKIKYIAVGNEISPVTGTSSLTSFQVPALVNIYKAVGEAGLMATSQIAVIVLLGLLVATNIHITEAQLGVCYGMMGNNLPSHSEVIQLYKSMERTGGGSVGIVVSECGWPSAGAFGATQDNAATYLRNLIQHAKEGSPRKPNIYPYFSYSGNPGQISLPYALFTAPNVVVQDGSRQYRNLFDAMLDSVYAARNIGRLRLYDPNQGALNALRGSNIEVILGLPNVDVKHIASGMEHARWWVQ |
| Sequence Length | 363 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 39759.18 |
| Monoisotopic Molecular Weight (Da) | 39734.15 |
| Isoelectric Point (pI) | 6.35 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P52401 |
| NCBI | --NA-- |
| EMBL | U01901 |
| Link to Source Databases | SPdb69253 |
|---|
| Addtional Information | FUNCTION:Is thought to be an important plant defense-related product against fungal pathogens.CATALYTIC ACTIVITY:Hydrolysis of 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans.TISSUE SPECIFICITY:High levels in leaves. Appreciable amounts in stems, roots, and sepals. Tubers, root tips, and all other flower organs contain very low levels of enzyme.DEVELOPMENTAL STAGE:Highest levels in old segments of leaves, stems and roots.INDUCTION:In leaves, in response to infection, elicitor, ethylene, or wounding.SIMILARITY:Belongs to the glycosyl hydrolase 17 family. |
