Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_5369 |
| Peptide Name | XTH8_ORYSJ |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Oryza sativa subsp. Japonica |
| Plant Source (Common Name) | Rice |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Apoplast; Cell wall; Cell wall biogenesis/degradation; Direct protein sequencing; Glycoprotein; Glycosidase; Hydrolase; Secreted; Signal; Transferase | Xyloglucan endotransglycosylase/hydrolase protein 8 precursor,(EC 2.4.1.207) (End-xyloglucan transferase) (OsXTH8) (OsXRT5).Secreted, cell wall (Probable). Secreted, extracellular space, apoplast (Probabl |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | ELDGAELGTVAWAERNYMSYNYCADGWRFPQGFPAECYRKGDGHDEIDIEFMGNLSGNPYVMNTNVWANGDGKKEHQFYLWFDPTADFHTMAKHLALSVAAAVAVSWLAASSAAAAGFYEKFDVVGAGDHVRVVSDDGKTQQVALTLDRSSGSGFTSKDTYLFGEFSVQMKLVGGNSAGTVTSFYLSSGERHGDVKIDWSGAPFVVSYRGYSTNACVNNNPAGGWSSSWCPEGTSAWIHRYKIIWNPQNIIFQVDDVPVRTFKKYDDLAYPQSKPMRLHATLWDGSYWAT |
| Sequence Length | 290 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 32096.61 |
| Monoisotopic Molecular Weight (Da) | 32076.25 |
| Isoelectric Point (pI) | 5.31 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | Q76BW5 |
| NCBI | --NA-- |
| EMBL | AB110604 |
| Link to Source Databases | SPdb320848 |
| Addtional Information | FUNCTION:Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity). May promote elongation of three internodes (II, III and IV) and may be involved in cell elongation processes.CATALYTIC ACTIVITY:Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.TISSUE SPECIFICITY:Transcript strongly detected in leaf sheaths.Weakly or not expressed in leaf blades, roots and calli.Accumulation of transcript detected in shoot apex meristem, vascular tissues, young leaves, vascular bundles of leaf sheaths, and peripheral cylinder of the vascular bundles and fibers in the nodal region.INDUCTION:By gibberellic acid (GA3). Accumulation continues to increase throughout 24 hours of GA3 treatment. Very little effect by other plant hormones like brassinolide (BL), 6-benzyladenine (BA), indole-3-acetic acid (IAA), and abscisic acid (ABA).Inhibitory effect from uniconazole, a potent GA biosynthesis inhibitor.PTM:Contains at least one intrachain disulfide bond essential for its enzymatic activity (By similarity).MISCELLANEOUS:Plants lacking XTH8 exhibit up to 50% growth reduction when they reach maturity. Lower level of XTH8 transcript detected in Tanginbozu, a GA-deficient semidwarf mutant, and higher level detected in Slender rice 1 (slr1), a GA-insensitive mutant showing a constitutive GA-response phenotype.SIMILARITY:Belongs to the glycosyl hydrolase 16 family. XTH group 2 subfamily. |