Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5300 |
| Peptide Name | LEC1_CLALU |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Cladrastis lutea |
| Plant Source (Common Name) | Yellow wood |
| Plant Family | Fabaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Calcium; Direct protein sequencing; Glycoprotein; Lectin; Manganese; Mannose-binding; Metal-binding; Signal | Agglutinin-1 precursor (Agglutinin I) (ClAI) (LecClAI) [Contains:,Agglutinin-1 subunit A; Agglutinin-1 subunit B]. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | EDLIFQKDASISSNETLELTRISSSGQPATSSVGRALYYTPVRLWDKSTGMTISNTNFLETKKPLSLPLLAFITIYLMLLHRVNSSDSLSFTFNNFPPNSQWQWQNGVKATAQISYNPASQKLTAVTSYPNSTPLTVSLDIDLQTVLPEWRLASFKTTFSFAITSPTQDPGDGFAFFIAPPDTTPGYGGGLLGLFNGFNLRNSSNNGVAVNNQSAQIVAVEFDTYINGQCDPKYRHVGIDVNSITSLAYTVRVGFSASTGQNVERNSILAWSFSSSLTTLTAKKEDMYIARYV |
| Sequence Length | 293 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 32128.05 |
| Monoisotopic Molecular Weight (Da) | 32108.18 |
| Isoelectric Point (pI) | 6.17 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q39528 |
| NCBI | --NA-- |
| EMBL | U21958 |
| Link to Source Databases | SPdb137497 |
|---|
| Addtional Information | FUNCTION:Mannose/glucose binding bark lectin.FUNCTION:Bark lectins are storage proteins that probably maintain stocks of nitrogen during dormant period. Self-aggregatable molecules that can bind their own carbohydrate side chains. They could also play a role in the plant's defense against phytophagous invertebrates or herbivorous higher animals.SUBUNIT:Homotetramer of four 32 kDa monomers which are post- translationally cleaved into a two subunits: A and B.MISCELLANEOUS:Binds one manganese (or other transition metal) ion and one calcium ion. The metal ions are essential for the saccharide-binding and cell-agglutinating activities (By similarity).SIMILARITY:Belongs to the leguminous lectin family. |
