Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_5119 |
| Peptide Name | PER20_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Alternative splicing; Calcium; Complete proteome; Glycoprotein; Heme; Hydrogen peroxide; Iron; Metal-binding; Oxidoreductase; Peroxidase; Secreted; Signal | Peroxidase 20 precursor (EC 1.11.1.7) (Atperox P20) (ATP28a).Secreted (By similarity). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | DLFFIDFVESMLKMGNINVLTGIEGEIRENCRFVNIEVAVLKDPRMAASLLRLQFHDCFVLGCDASVLLDTHGDMLSEKQATPNLNKARCVSFKQRIVQPNMEQTFYVDEFRRHSTFRRVLGSQCKDSSRDNELSPLDIKTPAYFDNHYFINLLEGRGLLISDNVLVSEDHEGEIFQKVWEYAVNQMEIKQKKVWLSLIVLYAITTSVLGDFGEPLLKGFYKESCPLAEEIVKHNIRRDSLKASFAGANQFIPAPNSSLDSLIINFKQQGLNIQDLIALSGAHTIGSLRGFEVIDYIKYLLEEACPLTVSCSDILALAARDSVFLRGGPWWEVLLG |
| Sequence Length | 336 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 37977.66 |
| Monoisotopic Molecular Weight (Da) | 37953.45 |
| Isoelectric Point (pI) | 5.28 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q9SLH7 |
| NCBI | --NA-- |
| EMBL | AC005314 |
| Link to Source Databases | SPdb187738 |
|---|
| Addtional Information | FUNCTION:Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.FUNCTION:May be implicated in the systemic acquired resistance response via the salicylic acid signal transduction pathway.CATALYTIC ACTIVITY:Donor H(2)O(2) = oxidized donor 2 H(2)O.COFACTOR:Binds 1 heme B (iron-protoporphyrin IX) group per subunit (By similarity).COFACTOR:Binds 2 calcium ions per subunit (By similarity).ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=1; Comment=A number of isoforms are produced. According to EST sequences; Name=1; IsoId=Q9SLH7-1; Sequence=Displayed;INDUCTION:Late induced by benzothiadiazol, a chemical analog of salicylic acid. Enhanced expression following incompatible bacterial pathogen attack.MISCELLANEOUS:There are 73 peroxidase genes in A.thaliana.SIMILARITY:Belongs to the peroxidase family. Classical plant (class III) peroxidase subfamily. |
