Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_5006 |
| Peptide Name | AMY6_HORVU |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Hordeum vulgare |
| Plant Source (Common Name) | Barley |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Calcium; Carbohydrate metabolism; Germination; Glycosidase; Hydrolase; Metal-binding; Signal | Alpha-amylase type B isozyme precursor (EC 3.2.1.1) (1,4-alpha-D-,glucan glucanohydrolase) (Clones GRAMY56 and 963). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | DDIAAAGVTHVWLPPASQSVAEQGYMPGRLYDLDASKYGNKAQLKSLIGADRPYPDGTGNRPTRTRADFGAAPDIDHLNPRVQKELVEWLNWLRTDDGFDFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIEGKVIVKLGPRYDVGHLIPEGFKVVAHGNDYAVWEKVGWRFDFAKGYSADVAKIYVDRSEPSFAVAEIWTSLAYGGDGKPNLNQDPHGWWPAKAVTFVDNHDTGSTQHMWPFPSDRVMQGYAYILTHPGNPCIFYDHLHGKAVKAIADIVINHRTAERKDGRGIYCIFEGGTPDARLDWGPHMICRDMANKHMSLSLFIVLLGLSCSLASGQVLFQGFNWESWKHNGGWYNFLMGKVRQELVNWVNKVGGSGPATTFDFTTKGILNVAVEGELWRLRGTDGKAPGMI |
| Sequence Length | 429 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 47937.21 |
| Monoisotopic Molecular Weight (Da) | 47906.93 |
| Isoelectric Point (pI) | 6.02 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P04750 |
| NCBI | --NA-- |
| EMBL | X15227 |
| Link to Source Databases | SPdb9185 |
| Addtional Information | CATALYTIC ACTIVITY:Endohydrolysis of 1,4-alpha-D-glucosidic linkages in oligosaccharides and polysaccharides.COFACTOR:Binds 3 calcium ions per subunit (By similarity).SUBUNIT:Monomer (By similarity).DEVELOPMENTAL STAGE:Production of alpha-amylase is hormonally regulated. Germinating embryos produce the hormone gibberellic acid, which within 10 hours stimulates the aleurone cells covering the endosperm of the seed to produce alpha-amylase. The enzyme then degrades the starch within the endosperm for use by the developing plant embryo.MISCELLANEOUS:There are at least 4 types of alpha-amylase in barley.MISCELLANEOUS:Type B isozyme mRNA is undetectable in unstimulated cells and increases a hundred-fold after stimulation with gibberellic acid.SIMILARITY:Belongs to the glycosyl hydrolase 13 family. |