Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_4993
Peptide Name	CRR60_ARATH
PMID(s)	--NA--
Plant Source (Scientific Name)	Arabidopsis thaliana
Plant Source (Common Name)	Mouse-ear cress
Plant Family	Brassicaceae
Peptide Family	--NA--
Peptide Function	Signaling-peptide
Peptide Function Description	Alternative splicing; Complete proteome; Repeat; Secreted; Signal | Cysteine-rich repeat secretory protein 60 precursor.Secreted (Potential).
Activity Against	--NA--
IC50 value	--NA--
Sequence	DCATCVARAVSQVGPLCPFTCGGALQLAGCYIKYDNISFLGQEDKTVVLKKCGSSEGYNTDGISRRDAVLTELVNGGGYFRAGGSGDVQGMGQCVGDLTVMPMAKLRNIIKTLSIFFFLIAATAPSLSSATSATDTFVFGGCSQQKFSPASAYESNLNSLLTSLVNSATYSSYNNFTIMGSSSSDTARGLFQCRGDLSMPSECQDCLGTAIGRLKNDCGTAVFGDMFLAKCYARYSTDGAQHYAKSHNYKTNYGGEKTFAIIIGLLAAVVLLIIFLLFLRGVCSRGGDFSILHSFTLI
Sequence Length	298
Validation	Experimental evidence at protein level
Average Molecular Weight (Da)	31603.1
Monoisotopic Molecular Weight (Da)	31582.51
Isoelectric Point (pI)	7.93
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_4993

External links (Uniprot, PDB and Source Information Database)
Uniprot	Q0WPN8
NCBI	--NA--
EMBL	AB018107
Link to Source Databases	SPdb48934
Addtional Information	ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q0WPN8-1; Sequence=Displayed; Name=2; IsoId=Q0WPN8-2; Sequence=VSP_027133, VSP_027134;SIMILARITY:Belongs to the cysteine-rich repeat secretory protein family.SIMILARITY:Contains 2 DUF26 domains.SEQUENCE CAUTION:Sequence=BAB08312.1; Type=Erroneous gene model prediction;