Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4987 |
| Peptide Name | E1310_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Alternative splicing; Cell wall; Cell wall biogenesis/degradation; Complete proteome; Glycoprotein; Glycosidase; GPI-anchor; Hydrolase; Lipoprotein; Membrane; Plant defense; Secreted; Signal | Putative glucan endo-1,3-beta-glucosidase 10 precursor (EC 3.2.1.39),((1->3)-beta-glucan endohydrolase 10) ((1->3)-beta-glucanase 10),(Beta-1,3-endoglucanase 10) (Beta-1,3-glucanase 10).Secreted, cell wall (Potential). Cell membrane; Lipid-anchor, GPI-anchor; Extrac |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | DAVGISYKKVPIVVSETGWPSNGDPQEVGATCDNARKYNGNLIKMMMSKKMASSSLQSLFSLFCLALFSLPLIVSSIGINYGQVANNLPPPKNVIPLLKSMRTPIRPECDLTIFVFALFNENMKPGPTSERNYGLFNPDGTPVYSLGIKTNVQAYLPNTKIVAIVVGNEVLTSNQSALTAALFPAMQSIHGALVDCGLNKQIFVTTAHSLAILDVSYPPSATSFRRDLLGSLTPILDFHVKTGSPILINASAGGKGRFVECVLFFFLLCIIKLRLSSTHSSGSGSSNSTGGSSSGGGGNTGGSSSGGGIYQPVTGNPSPDYMSISVGATKVKLYDADPQALRAFAGSGFELTVALGNEYLAQMSDPIKAQGWVKEYPFFAYEENPKHVSLDFVLFQPNQGFTDPGSNFHYDNMLFAQVDAVYHAL |
| Sequence Length | 425 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 45357.81 |
| Monoisotopic Molecular Weight (Da) | 45328.93 |
| Isoelectric Point (pI) | 7.17 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q9FHX5 |
| NCBI | --NA-- |
| EMBL | AB017067 |
| Link to Source Databases | SPdb69245 |
|---|
| Addtional Information | CATALYTIC ACTIVITY:Hydrolysis of 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans.ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9FHX5-1; Sequence=Displayed; Name=2; IsoId=Q9FHX5-2; Sequence=VSP_020752; Note=Derived from EST data. No experimental confirmation available;SIMILARITY:Belongs to the glycosyl hydrolase 17 family. |
