Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_4938 |
| Peptide Name | XTH12_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Apoplast; Cell wall; Cell wall biogenesis/degradation; Complete proteome; Glycoprotein; Glycosidase; Hydrolase; Secreted; Signal; Transferase | Probable xyloglucan endotransglucosylase/hydrolase protein 12,precursor (EC 2.4.1.207) (At-XTH12) (XTH-12).Secreted, cell wall (Probable). Secreted, extracellular space, apoplast (Probabl |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | CTLDKTSGSGFQSKKEYLFGKIDMKIKLVPGNSAGTVTAYYLSSKGETWDEIDFEFLGNVTGQPYVIHTNVFTGGKGNREMQFYLWFDPTADFHTYTVLWKVKTDWTNAPFSASYRSFNDVDCCSRTSIWNWVTCNANSNSWMWTTLNSNMAAFATKQSPLLLASLLILIGVATGSFYDSFDITWGAGRANIFESGQLLTNPLNIIFLVDGIPIRVFKNNEANGVAYPKSQPMKIYSSLWEADDWATQGGQLGQLKWVQKDYMIYNYCTDFKRFPQGLPTECNLN |
| Sequence Length | 285 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 32190.39 |
| Monoisotopic Molecular Weight (Da) | 32169.7 |
| Isoelectric Point (pI) | 5.74 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | Q9FKL9 |
| NCBI | --NA-- |
| EMBL | AB011482 |
| Link to Source Databases | SPdb320817 |
| Addtional Information | FUNCTION:Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity).CATALYTIC ACTIVITY:Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.TISSUE SPECIFICITY:Root specific.INDUCTION:Strongly down-regulated by abscisic acid (ABA).PTM:Contains at least one intrachain disulfide bond essential for its enzymatic activity (By similarity).SIMILARITY:Belongs to the glycosyl hydrolase 16 family. XTH group 2 subfamily.WEB RESOURCE:Name=XTH-World; URL="http://labs.plantbio.cornell.edu/XTH/"; |