Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_4924 |
| Peptide Name | PGLR_GOSHI |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Gossypium hirsutum, Gossypium mexicanum |
| Plant Source (Common Name) | Upland cotton |
| Plant Family | Malvaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Cell wall; Cell wall biogenesis/degradation; Glycoprotein; Glycosidase; Hydrolase; Repeat; Secreted; Signal | Polygalacturonase precursor (EC 3.2.1.15) (PG) (Pectinase). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | CSGSSPCQNVELADIDIKHNGAEPATSQCLNVKPITSGKLNPIPCSGPVPDAWKEACASVTPSTVVIPKGTYLLSKVNLEGPCKAPIEINVQGTIQAPADGIHMGKSEGVNIIASDIKTGDDCISIGDGTKNMVIKEITCGPGHGISIGSKTPSATALGKFQNEEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMMAPHLNIVPSMFVLLLLFISASKVQSDAFDVVAKFGAKADGKTDLSKPFLNIRFDFLTNALIQDITSKDSKLFHINVFACKNITLERLKIEAPDESPNTDNNVSSPILIDQQYCPWNKCKKNEESKVKLSNISFKNIRGTSALPEAIKFIPSAFKDPNWVRFYSVENFKMFGGGIFDGQGSIAYEKNTCENREFRSKLPV |
| Sequence Length | 407 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 43921.22 |
| Monoisotopic Molecular Weight (Da) | 43893.23 |
| Isoelectric Point (pI) | 6.44 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | Q39786 |
| NCBI | --NA-- |
| EMBL | U09717 |
| Link to Source Databases | SPdb189576 |
| Addtional Information | FUNCTION:May function in the depolymerization of the pectin in its walls during pollen tube elongation, or in that of the pistil during pollination.CATALYTIC ACTIVITY:Random hydrolysis of 1,4-alpha-D- galactosiduronic linkages in pectate and other galacturonans.TISSUE SPECIFICITY:Pollen.DEVELOPMENTAL STAGE:Appears 12 days before anthesis and maximum levels are seen in pollen on the day of anthesis.SIMILARITY:Belongs to the glycosyl hydrolase 28 family.SIMILARITY:Contains 5 PbH1 repeats. |