Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4883 |
| Peptide Name | LECT_SOLTU |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Solanum tuberosum |
| Plant Source (Common Name) | Potato |
| Plant Family | Solanaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Chitin-binding; Direct protein sequencing; Glycoprotein; Hydroxylation; Lectin; Repeat; Signal | Chitin-binding lectin 1 precursor (PL-I). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | CPGPYPEGRCGWQANGKSCPTGTGHCCSNAGWCGTTSDYCAPVNCQAQCNGPYPEGRCGWQANGKSCPTGTGQCCSNGGWCGTTSDYCASKNCQSQCKLPMKETAISVLALLTLFLLEVVSANELSLPFHLPINETIGLEVFQGINNASPPPPPPPALPYPQCGIKKGGGKCIKTGECCSIWGWCGTTNAYCSPGYCQKQPSPSPLPYPQCGMKKGGGKCIKTGECCSIWGWCGTTNAYCSPGYCQKQCPSPPPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASTTTLTSPIKNRMRGIESFMLNVV |
| Sequence Length | 323 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 33554.47 |
| Monoisotopic Molecular Weight (Da) | 33531.5 |
| Isoelectric Point (pI) | 8.4 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q9S8M0 |
| NCBI | --NA-- |
| EMBL | BG350800 |
| Link to Source Databases | SPdb137597 |
|---|
| Addtional Information | FUNCTION:This protein might function as a defense against chitin containing pathogens. Binds to several branched or linear N- acetyllactosamine-containing glycosphingolipids and also to lactosylceramide with sphingosine and non-hydroxy fatty acids.SUBUNIT:Homodimer (Probable).PTM:Heavily glycosylated with beta-arabinose on hydroxyprolines and with alpha-galactose on serines of the extensin-like domain.As no other sugars could be detected in the native lectin, it is unlikely that the three putative N-glycosylation sites are actually glycosylated.PTM:The N-terminus is blocked. The N-terminal sequences proposed in PubMed:9022287 and PubMed:11056399 originate probably from truncated proteins.SIMILARITY:In the central section; belongs to the extensin family.SIMILARITY:Contains 4 chitin-binding type-1 domains. |
