Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_4725
Peptide Name	CRK38_ARATH
PMID(s)	--NA--
Plant Source (Scientific Name)	Arabidopsis thaliana
Plant Source (Common Name)	Mouse-ear cress
Plant Family	Brassicaceae
Peptide Family	--NA--
Peptide Function	Signaling-peptide
Peptide Function Description	ATP-binding; Complete proteome; Glycoprotein; Kinase; Membrane; Nucleotide-binding; Receptor; Repeat; Serine/threonine-protein kinase; Signal; Transferase; Transmembrane | Cysteine-rich receptor-like protein kinase 38 precursor (EC 2.7.11.-),(Cysteine-rich RLK38).Membrane; Single-pass membrane protein (Potential).
Activity Against	--NA--
IC50 value	--NA--
Sequence	AYAWKCWVAGEAASIIDHVLSRSRSNEIMRFIHIGLLCVQENVSKRPTMSAYTRIRKSYNGINEAQYDYGGQSKLRFDFRMILTATDDFSFENKIGQGGFCTPDINSGACKRCLQASVTYFRDQNWGRQGGGICRPSCVFRWEFYPFYGAFANVTRVPAPPRALIPRTEAISITRLKGGIIAIFVVPIVINLLVFIGLIRFCNEGDEEILVYEFVPNSSLDHFIFDEEKRLLLTWDMRARIIEGVARGLVGSVYKGKLPGGEEIAVKRLTRGSGQGEIEFRNEVLLLTRLQHRNLVKLLGLSDKVTTNGGFYNASLDGVHVVGLCRRDYDRQGCINCVEESIRQIKTSCSLVIQWLGSETIAIPLPTVAGFTNASYQAEHEAGTLSLNELSITELSPRMKNSAAIFLTSSLILLLQTLHGVKAGFICVGSSFPTNSSYQKNRDSLFSTNMTLFRQEWEAMVDRTLEAVTIDNSTTVLKYYGALKSEFSEFPNVYMMMQNRVQSFHCNSDDRERVSCLVRTTDQSTYRILELGPATNDPSPVAIDTFAKVVGTFGYMAPEYVRNRTFSVKTDVYSFGVVLLEMITGRSNKNYFEALGLPYLHEDSQLRIIHRDLKASNILLDAYMNPKVADFGMARLFNMDQTRAVTRK
Sequence Length	648
Validation	Protein inferred from homology
Average Molecular Weight (Da)	72919.61
Monoisotopic Molecular Weight (Da)	72873.1
Isoelectric Point (pI)	8.6
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_4725

External links (Uniprot, PDB and Source Information Database)
Uniprot	Q9XEC8
NCBI	--NA--
EMBL	AF076243
Link to Source Databases	SPdb48757
Addtional Information	CATALYTIC ACTIVITY:ATP a protein = ADP a phosphoprotein.SIMILARITY:Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CRK subfamily.SIMILARITY:Contains 2 DUF26 domains.SIMILARITY:Contains 1 protein kinase domain.WEB RESOURCE:Name=Plant receptor kinase resource; URL="http://www.botany.wisc.edu/prkr/";