Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4672 |
| Peptide Name | RN28_PANGI |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Panax ginseng |
| Plant Source (Common Name) | Korean ginseng |
| Plant Family | Araliaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Direct protein sequencing; Signal; Storage protein | Ribonuclease-like storage protein precursor (Root 28 kDa major,protein). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | ATRFVDCPTDDATDDYRLKFVRLPSKMKFADPRTNSIIETNTEDIQFWEHEWKKHGRCSEALLKQTDYFRTALAFRKAFDIVGLLNQEGIYPNNDLYRPKMIKEAIKKHLNAVPEIDFTKNENSEYVLTDINVCVNQQMRAIYIISVIIVSLSIFSWGGNARSDYPWAMFALRLQWPAGFCEVNNACDTKSLLNTFTIHGLYPYNAKGTPALYCDGTAFDVNSVSDFLAEMHLAWPSH |
| Sequence Length | 238 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 27340.1 |
| Monoisotopic Molecular Weight (Da) | 27322.55 |
| Isoelectric Point (pI) | 5.88 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P83618 |
| NCBI | --NA-- |
| EMBL | AY496964 |
| Link to Source Databases | SPdb241278 |
|---|
| Addtional Information | FUNCTION:May act as a storage protein providing a nitrogen source. Seems to have no RNase activity although it has conserved the active site residues.SUBUNIT:Homodimer (Probable).TISSUE SPECIFICITY:Root.SIMILARITY:Belongs to the RNase T2 family. |
