Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_4655
Peptide Name	HPSE3_ARATH
PMID(s)	--NA--
Plant Source (Scientific Name)	Arabidopsis thaliana
Plant Source (Common Name)	Mouse-ear cress
Plant Family	Brassicaceae
Peptide Family	--NA--
Peptide Function	Signaling-peptide
Peptide Function Description	Alternative splicing; Complete proteome; Glycoprotein; Hydrolase; Lysosome; Membrane; Secreted; Signal | Heparanase-like protein 3 precursor (EC 3.2.-.-).Lysosome membrane; Peripheral membrane protein (By similarity). Secreted (By sim
Activity Against	--NA--
IC50 value	--NA--
Sequence	ATLDWWPPEKCDYGSCSWDHASILNLDLNNVILQNAIKAFAPLKIRIGGTDWFTEYLNKAENSLNATTRHIYDLGPGVDEHLIEKILNPSYLDQEAKSFRGTKKIRSYTHCARQSKGITVLLMNLDNTTTVVAKVELNNSFSLRHTKHMKLPPIEPIHINSTEPITIAPYSIVFVHMRNVVVPACALQDIVIYETPDSKQPCLPFTKNSSILFGYTQGCLPMRRWDELNAFFRKTGMAYRQILAIVLFLCVFQFLDCTVSSAVEENGTVFVYGRAAVGTIDEDFICNELCGSGVGARVGANQYAIDTINLRNIVNRVYKNVSPMPLVIGPGGFFEVSLKNIIKNSSTKAVAWVGESGGAYNSGRNLVSNAFVYSFWYLDQLGMASLSYKRASSQLFGGPNGVIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDTKVIFGLNALSGRSIKSNGEAIGAWNYTNAESFIRFTAENNYTIDGWELGYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTTFS
Sequence Length	536
Validation	Experimental evidence at transcript level
Average Molecular Weight (Da)	59709.05
Monoisotopic Molecular Weight (Da)	59671.08
Isoelectric Point (pI)	8.2
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_4655

External links (Uniprot, PDB and Source Information Database)
Uniprot	Q9FZP1
NCBI	--NA--
EMBL	AF096371
Link to Source Databases	SPdb115513
Addtional Information	FUNCTION:Endoglycosidase which is a cell surface and extracellular matrix-degrading enzyme. Cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans (By similarity).ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9FZP1-1; Sequence=Displayed; Name=2; IsoId=Q9FZP1-2; Sequence=VSP_018141, VSP_018142; Note=Derived from EST data. May be due to an intron retention.No experimental confirmation available;SIMILARITY:Belongs to the glycosyl hydrolase 79 family.SEQUENCE CAUTION:Sequence=AAC62790.1; Type=Erroneous gene model prediction; Sequence=AAC62794.1; Type=Erroneous gene model prediction; Sequence=BAB10787.1; Type=Erroneous gene model prediction;