Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_4545 |
| Peptide Name | CYF_NYMAL |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Nymphaea alba |
| Plant Source (Common Name) | White water-lily |
| Plant Family | Nymphaeaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Chloroplast; Electron transport; Heme; Iron; Membrane; Metal-binding; Photosynthesis; Plastid; Signal; Thylakoid; Transmembrane; Transport | Apocytochrome f precursor.Plastid, chloroplast thylakoid membrane; Single-pass membrane protein (By simila |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AQIFLVLKKKQFEKVQLAEMNFATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKKGGLNVGAVLILPEGFELAPPDRISPEMKEKMGNLSFQSYRPNKKNILVKSNNTVYNASAAGIVSKIVRKEKKGGYEITISDASNGHETVDIIPPGPELLVSEGEYIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRIQGLLFFLASVILMQKNRNTFSWVKEQMTRCISVSMMIYVITRASISNAYPIFAQQSYENPREVGPVPGQKYSEIVFPILSPDPATKKEVHFLKYPIYVGGNRGRGQIYPDGS |
| Sequence Length | 322 |
| Validation | Protein inferred from homology |
| Average Molecular Weight (Da) | 35568.19 |
| Monoisotopic Molecular Weight (Da) | 35545.65 |
| Isoelectric Point (pI) | 8.91 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | Q6EW40 |
| NCBI | --NA-- |
| EMBL | AJ627251 |
| Link to Source Databases | SPdb55110 |
| Addtional Information | FUNCTION:Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions (By similarity).SUBUNIT:The 4 large subunits of the cytochrome b6-f complex are cytochrome b6, subunit IV (17 kDa polypeptide, petD), cytochrome f and the Rieske protein, while the 4 small subunits are petG, petL, petM and petN. The complex functions as a dimer (By similarity).SIMILARITY:Belongs to the cytochrome f family. |