Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_4365
Peptide Name	PRO28_ORYSJ
PMID(s)	--NA--
Plant Source (Scientific Name)	Oryza sativa subsp. Japonica
Plant Source (Common Name)	Rice
Plant Family	Poaceae
Peptide Family	--NA--
Peptide Function	Signaling-peptide
Peptide Function Description	Pyrrolidone carboxylic acid; Seed storage protein; Signal; Storage protein; Vacuole | Prolamin PPROL 17D precursor.Vacuole, aleurone grain. Note=In rice prolamin accumulates as type I protein bod
Activity Against	--NA--
IC50 value	--NA--
Sequence	AIVQQLRLQQFASVYFDQSQAQAQAMLALNMPSICGIYPSYNTAPCSIPTMKIIFFFALLAIAACSASAQFDAVTQVYRQYQLQPHLMLQQQMLSPCGEFVGGIWYVRQQCSTVATPFFQSPVFQLRNCQVMQQQCCQQLRMIAQQSHCQAISSVQ
Sequence Length	156
Validation	Experimental evidence at transcript level
Average Molecular Weight (Da)	17562.42
Monoisotopic Molecular Weight (Da)	17550.55
Isoelectric Point (pI)	8.44
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_4365

External links (Uniprot, PDB and Source Information Database)
Uniprot	P20698
NCBI	--NA--
EMBL	M23745
Link to Source Databases	SPdb197703
Addtional Information	FUNCTION:Seed storage protein; serve as a source of nitrogen, carbon, and sulfur for the young developing seedling.MISCELLANEOUS:Lacks significant tandem repetitive sequences.SIMILARITY:Belongs to the prolamin family.SEQUENCE CAUTION:Sequence=AAA50423.1; Type=Frameshift; Positions=Several; Sequence=AAA50423.1; Type=Miscellaneous discrepancy; Note=Sequencing errors;