Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_4288 |
| Peptide Name | LEC_LENCT |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Lens culinaris Tomentosus, Lens tomentosus |
| Plant Source (Common Name) | Lentil, Lentil |
| Plant Family | Fabaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Calcium; Lectin; Manganese; Metal-binding; Signal | Lectin precursor [Contains: Lectin beta chain; Lectin alpha chain]. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AHEVHSWSFHSELGGTSSSKQAADADTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATIDAPSSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFMASLQTQMISFYLIFLSILLTTIFFFKVNSTETTSFSITKFSPDQQNLIFNVLTVTLTYPNSLEEENVTSYTLNEVVPLKDVVPEWVRIGFSATTGAEFAQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGSVANFVTSFTFV |
| Sequence Length | 275 |
| Validation | Protein inferred from homology |
| Average Molecular Weight (Da) | 30252.81 |
| Monoisotopic Molecular Weight (Da) | 30234.14 |
| Isoelectric Point (pI) | 5.22 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | Q8VXF2 |
| NCBI | --NA-- |
| EMBL | AJ421799 |
| Link to Source Databases | SPdb137613 |
| Addtional Information | FUNCTION:D-mannose specific lectin (By similarity).SUBUNIT:Heterotetramer of two alpha and two beta chains (By similarity).PTM:The mature form consists of two chains, alpha and beta, produced by cleavage of the immature protein. These remain cleaved, yet fold together to form one subunit (By similarity).MISCELLANEOUS:Binds two manganese (or other transition metal) ions and two calcium ions per heterotetramer. The metal ions are essential for the saccharide-binding activity (By similarity).SIMILARITY:Belongs to the leguminous lectin family. |