Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_4211 |
| Peptide Name | SPOR2_IPOBA |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Ipomoea batatas |
| Plant Source (Common Name) | Sweet potato |
| Plant Family | Convolvulaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Signal; Storage protein; Vacuole | Sporamin B precursor (Clone PIM0535).Vacuole. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AGENYYMVSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITIALSNIPFVFVIKPTDMEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLMKAFALFFVLSLYLLPNPTHSKFNPIRLRPAHETASSETPVLDINGDEVRTPADPEATVVMPSTYQTFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAG |
| Sequence Length | 216 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 24032.11 |
| Monoisotopic Molecular Weight (Da) | 24016.89 |
| Isoelectric Point (pI) | 5.39 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P14716 |
| NCBI | --NA-- |
| EMBL | X15094 |
| Link to Source Databases | SPdb274727 |
| Addtional Information | FUNCTION:Major tuberous root protein.TISSUE SPECIFICITY:Accumulates specifically in tuberous roots and tubers upon tuberization. Sporamin accounts 60 to 80% of the total soluble protein of the organ.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family. |