Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_4174 |
| Peptide Name | AMY3E_ORYSJ |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Oryza sativa subsp. Japonica |
| Plant Source (Common Name) | Rice |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Alternative splicing; Calcium; Carbohydrate metabolism; Glycosidase; Hydrolase; Metal-binding; Signal | Alpha-amylase isozyme 3E precursor (EC 3.2.1.1) (1,4-alpha-D-glucan,glucanohydrolase). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AFHDKNVECLADIVINHRCADYKDSRGVYCVFEGGTPDGRLDWGPDMICSDDTQYSNGRGHRDTGAGFGAAPDIDHLNPRVQRELTDWLNWLRTDLGFDGMGKHHVTLCCVVFAVLCLASSLAQAQVLFQGFNWESWRKQGGWYNFLHEKPDQAVTFVDNHDTGSTQSLWPFPSDKVMQGYAYILTHPGIPCIFYDHVFDQELVNWVEGVGKPATAFDFTTKGILQAAVQGELWRLHDGNGKAPGLMGWMVEEIASTGATHVWLPPPSHSVSPQGYMPGRLYDLDASKYGTEAELKSLIEWNLQHEIATLAEIRSRNGIHAESTLDILKAEGDIYVAMIDGKVITKLGPRWRLDFAKGYSAPLARIYVDNTNPTFVVGEIWSSLIYNGDGKPSTNQDADRYDAGGIIPSDFHVVAHGNDYCVWEKEGLRVPAGRKHY |
| Sequence Length | 437 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 48707.65 |
| Monoisotopic Molecular Weight (Da) | 48676.77 |
| Isoelectric Point (pI) | 5.32 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P27934 |
| NCBI | --NA-- |
| EMBL | M59352 |
| Link to Source Databases | SPdb9177 |
| Addtional Information | FUNCTION:Important for breakdown of endosperm starch during germination.CATALYTIC ACTIVITY:Endohydrolysis of 1,4-alpha-D-glucosidic linkages in oligosaccharides and polysaccharides.COFACTOR:Binds 3 calcium ions per subunit (By similarity).SUBUNIT:Monomer.ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P27934-1; Sequence=Displayed; Name=2; IsoId=P27934-2; Sequence=VSP_016022, VSP_016023; Note=No experimental confirmation available;TISSUE SPECIFICITY:More abundant in germinating seeds than in young roots, young leaves and callus.DEVELOPMENTAL STAGE:Expressed at a high level during germination in the aleurones cells under the control of the plant hormone gibberellic acid and in the developing grains at a low level.SIMILARITY:Belongs to the glycosyl hydrolase 13 family.SEQUENCE CAUTION:Sequence=BAD73794.1; Type=Erroneous gene model prediction; Sequence=BAD73796.1; Type=Erroneous gene model prediction; |