Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4158 |
| Peptide Name | CALX_PEA |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Pisum sativum |
| Plant Source (Common Name) | Garden pea |
| Plant Family | Fabaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Calcium; Chaperone; Endoplasmic reticulum; Glycoprotein; Lectin; Membrane; Repeat; Signal; Transmembrane | Calnexin homolog precursor.Endoplasmic reticulum membrane; Single-pass type I membrane protein (By similari |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AESYRETTWKPKFNIEKEKQKHEEEAAAAAAARSESEGIAGIQKKAFDLLDGTVVLQFETRLQNGLECGGAYIKYLQTQESGWKPKGFDNESGYSIMFGPDRCGATNKVHFIFRHKNPKTGKHVEHHLKFPPSVPSDKLSHVYTAVLKDDEDGEWEAPKIENPKCEAAPGCGEWKRPTKSNPAYKGKWSAPYIDNPNYKGGGKKPANVEANVEKKKTNTETTSKQDGGEKEDNKEKEETANPPRRRPKRDIWKPQEIPNPEYFELEKPDFEPIAAIGIEIWTMQDGILFDNVLIAKDDKIMVDRKEIPLAMGLLAVLLFFVASSSSFHLVRASDEVDDAIFYESFDEDFDNNEVSILIDGEEKKKANFLSSEDFEPALIPSKTIPDPDDKKPEDWDERAKINRWIVSGKEEYNGVWKHSKSEGHDDFGLLVSEPARKYAIVKELDAPVSLKPDPEAVKPEDWDEDAPREIIDEEAEKPEPWLDHEPEVDDPEAKPEDWDDEYKIADIAFLSGQKEKIIEIIEKGEKQPNLTIGIIVSVVIVFVSIFFRLIF |
| Sequence Length | 551 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 62532.06 |
| Monoisotopic Molecular Weight (Da) | 62493.38 |
| Isoelectric Point (pI) | 4.84 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | O82709 |
| NCBI | --NA-- |
| EMBL | Y17329 |
| Link to Source Databases | SPdb28947 |
|---|
| Addtional Information | FUNCTION:Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins (By similarity).TISSUE SPECIFICITY:In vegetative and flowering tissues.SIMILARITY:Belongs to the calreticulin family. |
