Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_4085 |
| Peptide Name | INV2_ORYSJ |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Oryza sativa subsp. Japonica |
| Plant Source (Common Name) | Rice |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Apoplast; Cell wall; Glycoprotein; Glycosidase; Hydrolase; Secreted; Signal | Beta-fructofuranosidase, insoluble isoenzyme 2 precursor (EC 3.2.1.26),(Sucrose hydrolase 2) (Invertase 2) (Cell wall beta-fructosidase 2),(OsCIN2).Secreted, extracellular space, apoplast (Probable). Secreted, cell wall (Probabl |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | ACILSRVYPSLAIGKNARLYVFNNGKAEIKVSQLTAWEMKKPVMMNGAARGADARGGVGPFGLWVLASAGLEEKTAVFFRVFRPAARGGGAGKPVVLMCTDPTKSSRNPNMYQPTFAGFVDTDITNGKISLRSLIDRSVVESFGAGGKDRVVKPGEHVEVTGLQTAQADVEVSFEVGSLEAAERLDPAMAYDAQRLCSDSELRTGYHFQPPKNWINDPNAPMYYKGWYHLFYQYNPKGAVWGNIVWAHDTAADDVAKGWAGIQAIPRKVWLDPSGKQLLQWPIEEVERLRGKWPVILKDVNYQVQNVALPRNGSDPLLREWVKPGHNPVIVPEGGINATQFRDPTTAWMGVLGSRVAWAWLVQLLLLQQLAGASHVVYDDLELQAAATTADGVPPSIVPDFYPVTADGRREGVDTSSAVVDAAASARVKYVLKNSLDLRRYDYYTVGTRGADGHWRLLVGSLAGQSRGVAYVYRSRDFRRWTRAAQPLHSAPTGMWECSVSRDLINWVALKPAIEPSIRADKYGCWSGSATMMADGTPVIMYTGVNRPYDRKAERYVPDDPAGDEHHIRYDYGNFYASKTFYDPAKRRRILWGWANES |
| Sequence Length | 598 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 66263.22 |
| Monoisotopic Molecular Weight (Da) | 66221.57 |
| Isoelectric Point (pI) | 8.97 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | Q0JDC5 |
| NCBI | --NA-- |
| EMBL | AY578159 |
| Link to Source Databases | SPdb125253 |
| Addtional Information | FUNCTION:May play a role in sucrose partitioning during seed development.CATALYTIC ACTIVITY:Hydrolysis of terminal non-reducing beta-D- fructofuranoside residues in beta-D-fructofuranosides.TISSUE SPECIFICITY:Expressed in leaves and flowers. Weakly expressed in seeds.DEVELOPMENTAL STAGE:Expressed throughout flowering, with higher expression from 1 to 6 days after flowering.INDUCTION:By sucrose in caryopsis from 1 to 2 and from 9 to 10 days after flowering.SIMILARITY:Belongs to the glycosyl hydrolase 32 family.SEQUENCE CAUTION:Sequence=CAD40589.2; Type=Erroneous gene model prediction; Sequence=EAZ30682.1; Type=Erroneous gene model prediction; |