Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_4051 |
| Peptide Name | XIP1_ORYSJ |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Oryza sativa subsp. Japonica |
| Plant Source (Common Name) | Rice |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Plant defense; Secreted; Signal | Xylanase inhibitor protein 1 precursor (Class III chitinase homolog a),(RIXI protein).Secreted (Potential). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AANVPGKNDNVFIKQLYYDLLPNVQKAKNYGGIMLWDRFYDKQTGYGKTVDFFIDQGAPDHYDDLARNLYAYNKMYRARTPVRLTATVRCAFPDPRMKKAETCDTGLYTTVVISFYSVFGHGRYWGDLSGHDLRVIGADIKHCQSKNIFVFLSIGGAGKDYSLPTSKSAADVADNIWNAHMDGRRPGVFRPFGDAAVDGIKYWALDTKLFERIHVRFYDDATCSYNHAGLAGVMAQWNKWTARYPGSHVYLGLAMVALGRRSWLVPLAMVLAVSSCLAGPAMAAGKTGQMTVFWGRNKNEGTLK |
| Sequence Length | 304 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 33946.81 |
| Monoisotopic Molecular Weight (Da) | 33924.99 |
| Isoelectric Point (pI) | 9.33 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | Q7GCM7 |
| NCBI | --NA-- |
| EMBL | D55712 |
| Link to Source Databases | SPdb320524 |
| Addtional Information | FUNCTION:Fungal xylanase inhibitor. Possesses competitive inhibiting activity against fungal endo-1,4-beta-D-xylanases belonging to glycoside hydrolase family 11 (GH11). May function in plant defense against secreted fungal pathogen xylanases. Is similar to class III chitinases, but does not exhibit chitinase activity.SUBUNIT:Binds to fungal GH11 xylanases.SIMILARITY:Belongs to the glycosyl hydrolase 18 family. Xylanase inhibitor subfamily. |