Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_4036
Peptide Name	PEL15_ARATH
PMID(s)	--NA--
Plant Source (Scientific Name)	Arabidopsis thaliana
Plant Source (Common Name)	Mouse-ear cress
Plant Family	Brassicaceae
Peptide Family	--NA--
Peptide Function	Signaling-peptide
Peptide Function Description	Calcium; Complete proteome; Glycoprotein; Lyase; Metal-binding; Signal | Probable pectate lyase 15 precursor (EC 4.2.2.2) (Pectate lyase A11).
Activity Against	--NA--
IC50 value	--NA--
Sequence	AAIRKLKTEEFQSLNSSTMAATRLDGEPQQQQHAVADDPDMVADEVAKLVLKQELIMNSFKTIDARGSNVHIANGACITIQFITNVIIHGLHIHDCKPTGMASSSQKLISVCVAVLVVLALTAMIFRNSEISLSRKLKTEVIQSSNSSTMMVDTITSTAGALGCRKGRPCNAIGGRDGRFYIVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIENAMVRSSPSHFGWRTMADGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDRNWHKNRKRLADCGIGFGRRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAFFRPSGAGASASYGRASSLAAKPSSSTAITVSNNHFTHHNEVMLLGHSDSYTKDKLMQVTIAYNHFGEGLVQRMP
Sequence Length	470
Validation	Experimental evidence at transcript level
Average Molecular Weight (Da)	51935.85
Monoisotopic Molecular Weight (Da)	51902.64
Isoelectric Point (pI)	8.44
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_4036

External links (Uniprot, PDB and Source Information Database)
Uniprot	Q944R1
NCBI	--NA--
EMBL	AL035528
Link to Source Databases	SPdb187119
Addtional Information	CATALYTIC ACTIVITY:Eliminative cleavage of (1->4)-alpha-D- galacturonan to give oligosaccharides with 4-deoxy-alpha-D-galact- 4-enuronosyl groups at their non-reducing ends.COFACTOR:Binds 1 calcium ion. Required for its activity (By similarity).TISSUE SPECIFICITY:Expressed in flowers, but not in leaves.SIMILARITY:Belongs to the polysaccharide lyase 1 family.SEQUENCE CAUTION:Sequence=CAB36835.1; Type=Erroneous gene model prediction; Sequence=CAB78413.1; Type=Erroneous gene model prediction;