Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_3975 |
| Peptide Name | Mc-AMP1 |
| PMID(s) | 1733929, 7647302 |
| Plant Source (Scientific Name) | Mesembryanthemum crystallinum |
| Plant Source (Common Name) | Common ice plant |
| Plant Family | Aizoaceae |
| Peptide Family | Knottin |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | possesses antifungal and antibacterial activity |
| Activity Against | Gram-positive bacteria: Bacillus megaterium (IC50= 2 µg/mL), Sarcina lutea (IC50= 50 µg/mL). NOTE! not active against Erwinia carotovora, Escherichia coli. Fungi: Alternaria brassicola (IC50= 6 µg/mL), Ascochyta pisi (IC50= 6 µg/mL), Botrytis cinerea (IC50= 2 µg/mL), Cercospora beticola (IC50= 2 µg/mL), Colletotrichum lindemuthianum (IC50= 1 µg/mL), Fusarium culmorum (IC50= 3 µg/mL), Fusarium oxysporum f. sp. Pisi (IC50= 5 µg/mL), Fusarium oxysporum f. sp. Lycopersici (IC50= 10 µg/mL), Nectria haematococca (IC50= 0.5 µg/mL), Phoma betae (IC50= 6 µg/mL), Pyrenophora tritici-repentis (IC50= 20 µg/mL), Pyricularia oryzae (IC50= 0.5 µg/mL), Rhizoctonia solani (IC50= 15 µg/mL), Verticiliium dahliae (IC50= 0.5 µg/mL), Venturia inaequalis (IC50= 1 µg/mL). |
| IC50 value | 2 µg/mL | 50 µg/mL | 6 µg/mL | 6 µg/mL | 2 µg/mL | 2 µg/mL | 1 µg/mL | 3 µg/mL | 5 µg/mL | 10 µg/mL | 0.5 µg/mL | 6 µg/mL | 20 µg/mL | 0.5 µg/mL | 15 µg/mL | 0.5 µg/mL | 1 µg/mL |
| Sequence | AKCIKNGKGCREDQGPPFCCSGFCYRQVGWARGYCKNR |
| Sequence Length | 38 |
| Validation | Protein inferred from homology |
| Average Molecular Weight (Da) | 4287.96 |
| Monoisotopic Molecular Weight (Da) | 4284.96 |
| Isoelectric Point (pI) | 9.3 |
| Method / Extraction | --NA-- |
