Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_3971 |
| Peptide Name | Fabatin-2 |
| PMID(s) | 97257504, 27208129, 9103978 |
| Plant Source (Scientific Name) | Vicia faba |
| Plant Source (Common Name) | Broad bean |
| Plant Family | Fabaceae |
| Peptide Family | Defensin |
| Peptide Function | Antibacterial |
| Peptide Function Description | is active against Gram-positive and Gram-negative bacteria |
| Activity Against | Gram-positive bacteria: Bacillus subtilis, Enterococcus hirae. Gram-negative bacteria: Escherichia coli, Pseudomonas aeruginosa. NOTE! Not active against Candida albicans and Saccharomyces cerevisiae. |
| IC50 value | --NA-- |
| Sequence | LLGRCKVKSNRFNGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC |
| Sequence Length | 47 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5206.11 |
| Monoisotopic Molecular Weight (Da) | 5202.42 |
| Isoelectric Point (pI) | 9.12 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P81457 |
| NCBI | 3913646 |
| EMBL | --NA-- |
| Link to Source Databases | PhytAMP_PHYT00023, DBAASP_9710, EROP-Moscow_03432, DEFENSINS-Knowledgebase_387, CAMPSQ857, APD_00297 |
| Addtional Information | It contains four disulfide bonds:5,47; 16,36; 22,43; 26,45. Active against E. coli, P. aeruginosa, and E. hirae. The material used for antimicrobial activity assays contains both fabatin-1 and fabatin-2, which differ only at residue 13, N for fabatin-1 and H for fabatin-2. It's unclear whether these two very closely related fabatins differ in antimicrobial activity. Updated 12/2017. ; Fabatin-2 differs from fabatin-1 by only 1 amino acid at position 13, N in fabatin-2, H in fabatin-1., Synthesis Type: Ribosomal; 95% Inhibition against Lactobacillus brevis at 10.3 ¼g/ml; 95% Inhibition against Pediococcus dextrinicus at 11.2 ¼g/ml; 95% Inhibition against Staphylococcus aureus Newman at >45 ¼g/ml; 95% Inhibition against Bacillus cereus at >45 ¼g/ml; 95% Inhibition against at Salmonella typhimurium >45 ¼g/ml; 95% Inhibition against at Escherichia coli >45 ¼g/ml; 95% Inhibition against Pseudomonas aeruginosa at 10.3 ¼g/ml |