Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_3963 |
| Peptide Name | Vicilin-like Antimicrobial peptide 2a (MiAMP2a) |
| PMID(s) | 10571855, PPepDB_3963_ref1 |
| Plant Source (Scientific Name) | Macadamia integrifolia |
| Plant Source (Common Name) | Macadamia nut |
| Plant Family | Proteaceae |
| Peptide Family | Vicilin |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Participate in the innate immune response of plants, therapeutically useful as anticancer agents and novel antimicrobial compounds in the protection of crops to the disinfection of hospital environments. |
| Activity Against | Gram-positive bacteria: (Ca2, Ca2) (IC50 µg/mL) Clavibacter michiganensis(50, >50). Fungi: (Ca2, Ca2) (IC50 µg/mL) Alternaria helianthi (510, ND), Ceratocystis paradoxa (2050, >50), Cercospora nicotianae (510, 510), Chalara elegans (25, 1020), Fusarium oxysporum (10, 2050), Leptosphaeria maculans (25, >50), Sclerotinia sclerotiorum (2050, >50), Verticillium dahliae (510, >50), Saccharomyces cerevisiae (2050, >50), Phytophthora cryptogea (510, 1025), Phytophthora parasitica nicotianae (1020, >50). NOTE! Ca2 = Medium with low content of CaCl2. NOTE! Ca2 = Medium supplemented with high concentration of CaCl2 (1 mM). |
| IC50 value | 52 µg/mL | >50 µg/mL | 510 µg/mL | 2050 µg/mL | >50 µg/mL | 510 µg/mL | 510 µg/mL | 25 µg/mL | 1020 µg/mL | 10 µg/mL | 2050 µg/mL | 25 µg/mL | >50 µg/mL | 2050 µg/mL | >50 µg/mL | 510 µg/mL | >50 µg/mL | 2050 µg/mL | >50 µg/mL | 510 µg/mL | 1025 µg/mL | 1020 µg/mL | >50 µg/mL |
| Sequence | ESEFDRQEYEECKRQCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQD |
| Sequence Length | 49 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 6103.6 |
| Monoisotopic Molecular Weight (Da) | 6099.59 |
| Isoelectric Point (pI) | 4.43 |
| Method / Extraction | --NA-- |
