Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_3862 |
| Peptide Name | La-LTP (LJAFP) |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Leonurus artemisia |
| Plant Source (Common Name) | Sagebrush motherwort |
| Plant Family | Lamiaceae |
| Peptide Family | Lipid-transfer protein |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | --NA-- |
| Activity Against | Gram-positive Bacteria: Bacillus subtilis (IC50= >15 µM). Gram-negative Bacteria: Pseudomonas solanAngiotensin Converting Enzymearum (IC50= 7.515 µM), Ralstonia solanAngiotensin Converting Enzymearum (IC50= 15 µM). NOTE! Not active against Agrobacterium radiobacter, Escherichia coli. Fungi: Alternaria alternate (IC50= <7.5 µM), Alternaria brassicae (IC50= <7.5 µM), Aspergillus niger (IC50= <7.5 µM), Bipolaris maydis (IC50= <7.5 µM), Botrytis cinerea (IC50= 7.515 µM), Cerospora personata (IC50= 7.515 µM), Colletotrichum gloeosporiodes (IC50= <7.5 µM), Fusarium graminearum (IC50= 7.515 µM), Fusarium oxysporum (IC50= 7.515 µM), Penicillium digitatum (IC50= >15 µM), Pyricularia grisea (IC50= 7.515 µM), Rhizoctonia solani (IC50= <7.5 µM), Rhizoctonia cerealis (IC50= 7.515 µM), Saccharomyces cerevisiae (IC50= >15 µM), Sclerotinia sclerotiorum (IC50= >15 µM), Trichoderma harzianum (IC50= 7.515 µM), Verticillium dahliae (IC50= 7.515 µM). |
| IC50 value | >15 µM | 7.515 µM | 15 µM | <7.5 µM | <7.5 µM | <7.5 µM | <7.5 µM | 7.515 µM | 7.515 µM | <7.5 µM | 7.515 µM | 7.515 µM | >15 µM | 7.515 µM | <7.5 µM | 7.515 µM | >15 µM | >15 µM | 7.515 µM | 7.515 µM |
| Sequence | AIGCNTVASKMAPCLPYVTGKGPLGGCCGGVKGLIDAARTTPDRQAVCNCLKTLAKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKVH |
| Sequence Length | 91 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 9125.64 |
| Monoisotopic Molecular Weight (Da) | 9119.53 |
| Isoelectric Point (pI) | 9.02 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q52RN7 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | PhytAMP_PHYT00112 |
|---|
| Addtional Information | NA |
