Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_3841 |
| Peptide Name | Viscotoxins 1-PS, A1, A2, A3, and B |
| PMID(s) | 4417993, 25815333 |
| Plant Source (Scientific Name) | Viscum album |
| Plant Source (Common Name) | European mistletoe |
| Plant Family | Santalaceae |
| Peptide Family | Thionin |
| Peptide Function | Anticancer |
| Peptide Function Description | Shows innate immune defense mechanism to treat infections caused by pathogenic bacteria to animals and humans. Display anticancer activities because of their ability to inactivate a wide range of cancer cells. Induce the production of reactive oxygen species (ROS) and cell membrane permeabilization ; is toxic to animal cells |
| Activity Against | Human lymphocytes |
| IC50 value | --NA-- |
| Sequence | KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYPK |
| Sequence Length | 46 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 4903.59 |
| Monoisotopic Molecular Weight (Da) | 4900.28 |
| Isoelectric Point (pI) | 9.13 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P01537, P32880 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | EROP-Moscow_04107, APD_01278 |
| Addtional Information | Structure is predicted. |