Detailed Peptide Information


This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking



Primary Information
PPepDB IDPPepDB_2528
Peptide NameAntimicrobial peptide Mj-AMP1
PMID(s)1733929
Plant Source (Scientific Name)Mirabilis jalapa
Plant Source (Common Name)Garden four-o'clock
Plant FamilyNyctaginaceae
Peptide Family--NA--
Peptide FunctionAntimicrobial, Antibacterial, Antifungal
Peptide Function Descriptionpossesses antifungal activity; is active against Gram-positive bacteria
Activity Against--NA--
IC50 value--NA--
SequenceJCIGNGGRCNENVGPPYCCSGFCLRQPGQGYPYCKNR
Sequence Length37
ValidationExperimental evidence at protein level
Average Molecular Weight (Da)4025.6
Monoisotopic Molecular Weight (Da)4022.77
Isoelectric Point (pI)8.64
Method / Extraction--NA--


Secondary Information
Tertiary Structure and DSSP ReportClick to View Structure
Physico-Chemical Properties of peptidesClick to View Physico-Chemical Details of PPepDB_2528


External links (Uniprot, PDB and Source Information Database)
UniprotP25403
NCBI--NA--
EMBL--NA--
Link to Source DatabasesEROP-Moscow_02405
Addtional InformationNA