Detailed Peptide Information


This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking



Primary Information
PPepDB IDPPepDB_2522
Peptide NameAntimicrobial peptide Vv-AMP14/15
PMID(s)20367609
Plant Source (Scientific Name)Vitis vinifera
Plant Source (Common Name)Grape
Plant FamilyVitaceae
Peptide Family--NA--
Peptide FunctionAntimicrobial
Peptide Function Description--NA--
Activity Against--NA--
IC50 value--NA--
SequenceJCGGQAGGRVCPGGACCSKFGRCGNTADYCGSGCQSQCSS
Sequence Length40
ValidationExperimental evidence at protein level
Average Molecular Weight (Da)3837.27
Monoisotopic Molecular Weight (Da)3834.5
Isoelectric Point (pI)8.14
Method / Extraction--NA--


Secondary Information
Tertiary Structure and DSSP ReportClick to View Structure
Physico-Chemical Properties of peptidesClick to View Physico-Chemical Details of PPepDB_2522


External links (Uniprot, PDB and Source Information Database)
UniprotA3QRB6
NCBI--NA--
EMBL--NA--
Link to Source DatabasesEROP-Moscow_09022
Addtional InformationNA