Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_2201
Peptide Name	Fa-AMP1
PMID(s)	15784998, 12951494
Plant Source (Scientific Name)	Fagopyrum esculentum
Plant Source (Common Name)	BuckWheat
Plant Family	Polygonaceae
Peptide Family	Chitin-binding, Hevein, Defensin
Peptide Function	Antibacterial, Antifungal
Peptide Function Description	Target site: lipid bilayer ; Shows antibacterial and antifungal activity in different species.
Activity Against	Erwinia carotovora subsp. carotovora (IC50: 11 µg/ml), Agrobacterium radiobacter (IC50: 24 µg/ml), Agrobacterium rhizogenes (IC50: 20 µg/ml), Clavibacter michiganensis subsp. michiganensis (IC50: 14 µg/ml), Curtobacterium flaccumfaciens pv. oortii (IC50: 13 µg/ml), Fusarium oxysporum (IC50: 19 µg/ml), Geotrichum candidum (IC50: 36 µg/ml)
IC50 value	11 µg/ml | 24 µg/ml | 20 µg/ml | 14 µg/ml | 13 µg/ml | 19 µg/ml | 36 µg/ml
Sequence	AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK
Sequence Length	40
Validation	Experimental evidence at protein level
Average Molecular Weight (Da)	3887.37
Monoisotopic Molecular Weight (Da)	3884.52
Isoelectric Point (pI)	8.22
Method / Extraction	MALDI-TOF MS a-lysis

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_2201

External links (Uniprot, PDB and Source Information Database)
Uniprot	P0DKH7
NCBI	745997996
EMBL	--NA--
Link to Source Databases	DBAASP_2737, PhytAMP_PHYT00229, EROP-Moscow_05770, CAMPSQ8180, APD_01587
Addtional Information	Synthesis Type : Ribosomal; Rich in Cys and Gly residues. It differs from Fa-AMP2 only in the last residue: Lys in Fa-AMP1 abd Arg in Fa-AMP2. For plant pathogenic bacterial and fungal strains, see APD entries 1585.