Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2198 |
| Peptide Name | Pp-AMP1 |
| PMID(s) | 15784998 |
| Plant Source (Scientific Name) | Phyllostachys pubescens |
| Plant Source (Common Name) | moso bamboo |
| Plant Family | Poaceae |
| Peptide Family | Chitin-binding, Thionin |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Target site: lipid bilayer , inhibits growth of plant patogenic fungi |
| Activity Against | Erwinia carotovora (IC50: 22 µg/ml), Agrobacterium radiobacter (IC50: 15 µg/ml), Agrobacterium rhizogenes (IC50: 15 µg/ml), Clavibacter michiganensis (IC50: 14 µg/ml), Curtobacterium flaccumfaciens (IC50: 25 µg/ml), Fusarium oxysporum (IC50: 2 µg/ml), Geotrichum candidum (IC50: 2 µg/ml) |
| IC50 value | 22 µg/ml | 15 µg/ml | 15 µg/ml | 14 µg/ml | 25 µg/ml | 2 µg/ml | 2 µg/ml |
| Sequence | KSCCRSTQARNIYNAPRFAGGSRPLCALGSGCKIVDDKKTPPND |
| Sequence Length | 44 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 4697.36 |
| Monoisotopic Molecular Weight (Da) | 4694.3 |
| Isoelectric Point (pI) | 9.44 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | --NA-- |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_2733, PhytAMP_PHYT00073, EROP-Moscow_05773, CAMPSQ3353, APD_01585 |
|---|
| Addtional Information | Synthesis Type : Ribosomal; The peptide is active against plant pathogenic Gram-positive (C. michiganensis and C. flaccumfaciens) and Gram- bacteria (E. carotovora, A. radiobacter and A. rhizogenes) at IC50=13-25 ug/ml and fungi (F. oxysporum and G. candidum) at IC50=2 ug/ml. Updated 10/2016. |
