Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2197 |
| Peptide Name | Pp-thionin |
| PMID(s) | 15494403, 3985614 |
| Plant Source (Scientific Name) | Pyrularia pubera |
| Plant Source (Common Name) | Buffalo nut |
| Plant Family | Santalaceae |
| Peptide Family | Thionin |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Target site: lipid bilayer; is toxic to animal cells; is active against Gram-negative and Gram-positive bacteria |
| Activity Against | Clavibacter michiganensis(EC50: 0.23 ±0.04 µM), Rhizobium meliloti(IC50: >20 ±0.0 µM), Xanthomonas campestris(IC50: 3.67 ±0.58 µM), Fusarium oxysporum(IC50: 0.38 ±0.08 µM) |
| IC50 value | >20 ±0.0 µM | 3.67 ±0.58 µM | 0.38 ±0.08 µM |
| Sequence | KSCCRNTWARNCYNVCRLPGTISREICAKKCDCKIISGTTCPSDYPK |
| Sequence Length | 47 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5288.19 |
| Monoisotopic Molecular Weight (Da) | 5284.48 |
| Isoelectric Point (pI) | 9.06 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P07504 |
| NCBI | 135798 |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_595, PhytAMP_PHYT00075, EROP-Moscow_02093, CAMPSQ137, APD_00236 |
|---|
| Addtional Information | Synthesis Type : Ribosomal; Three disulfide bridges: 3,41; 4,31; 16,27. | The D32R analogue was significantly more active than Pp-TH against several Gram-negative bacteria (R. meliloti, X. campestris pv. translucens and X. campestris pv. campestris) but comparable to Pp-TH against the Gram-positive bacterium C. michiganensis and the fungal plant pathogens P. cucumerina, F. oxysporum and B. Cinerea . |
