Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2195 |
| Peptide Name | MJ-AMP2 |
| PMID(s) | 2387889, 27208129, 1733929, 7647302 |
| Plant Source (Scientific Name) | Mirabilis jalapa |
| Plant Source (Common Name) | Garden four-o'clock |
| Plant Family | Nyctaginaceae |
| Peptide Family | Knottin |
| Peptide Function | Antibacterial, Antifungal, Hemolytic, Cytotoxic |
| Peptide Function Description | Target site: lipid bilayer; 5% Killing against Human endothelial cells at 500 µg/ml; 2% killing against Human fibroblasts at 500 µg/ml |
| Activity Against | Alternaria brassicicola (IC50: 6 µg/ml), Ascochyta pisi (IC50: 6 µg/ml), Botrytis cinerea (IC50: 2 µg/ml), Cercospora beticola (IC50: 2 µg/ml), Colletotrichum lindemuthianum (IC50: 1 µg/ml ), Fusarium culmorum (IC50: 3 µg/ml), Fusarium oxysporum f. sp. pisi (IC50: 5 µg/ml), Fusarium oxysporum f. sp. lycopersici (IC50: 10 µg/ml), Nectria haematococca (IC50: 0.5 µg/ml), Phoma betae (IC50: 6 µg/ml), Pyrenophora tritici-repentis (IC50: 20 µg/ml), Pyricularia oryzae (IC50: 0.5 µg/ml), Rhizoctonia solani (IC50: 15 µg/ml ), Verticillium dahliae (IC50: 0.5 µg/ml), Venturia inaequalis (IC50: 1 µg/ml), Bacillus megaterium (IC50: 2 µg/ml), Sarcina lutea (IC50: 50 µg/ml), Escherichia coli (IC50: >500 µg/ml), Erwinia carotovora (IC50: >500 µg/ml) |
| IC50 value | 6 µg/ml | 6 µg/ml | 2 µg/ml | 2 µg/ml | 1 µg/ml | 3 µg/ml | 5 µg/ml | 10 µg/ml | 0.5 µg/ml | 6 µg/ml | 20 µg/ml | 0.5 µg/ml | 15 µg/ml | 0.5 µg/ml | 1 µg/ml | 2 µg/ml | 50 µg/ml | >500 µg/ml | >500 µg/ml |
| Sequence | CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR |
| Sequence Length | 36 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3893.4 |
| Monoisotopic Molecular Weight (Da) | 3890.69 |
| Isoelectric Point (pI) | 8.69 |
| Method / Extraction | --NA-- |