Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2185 |
| Peptide Name | Floral defensin-like protein 2/PhD2 |
| PMID(s) | 12644678 |
| Plant Source (Scientific Name) | Petunia hybrida |
| Plant Source (Common Name) | Petunia |
| Plant Family | Solanaceae |
| Peptide Family | Defensin |
| Peptide Function | Antifungal |
| Peptide Function Description | Target site: lipid bilayer |
| Activity Against | Fungi: Fusarium oxysporum and Botrytis cinerea. NOTE! Not tested against bacteria. |
| IC50 value | --NA-- |
| Sequence | GTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLCTKPC |
| Sequence Length | 49 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5403.48 |
| Monoisotopic Molecular Weight (Da) | 5399.53 |
| Isoelectric Point (pI) | 8.76 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q8H6Q0 |
| NCBI | 44887845 |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_1953, PhytAMP_PHYT00025, CAMPSQ921, APD_00982 |
|---|
| Addtional Information | Synthesis Type : Ribosomal; shows 0% Inhibition against Fusarium oxysporum at 2 ¼g/ml|shows 86% Inhibition against Fusarium oxysporum at 10 ¼g/ml|shows 0% Inhibition against Botrytis cinerea at 2 ¼g/ml|shows 41% Inhibition against Botrytis cinerea at 10 ¼g/ml; It can form 5 S-S bonds. |
