Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2184 |
| Peptide Name | Vicilin-like Antimicrobial peptide 2c-3 / MiAMP2c-3 |
| PMID(s) | 10571855 |
| Plant Source (Scientific Name) | Macadamia integrifolia |
| Plant Source (Common Name) | Macadamia nut |
| Plant Family | Proteaceae |
| Peptide Family | Vicilin |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Target site: lipid bilayer |
| Activity Against | Alternaria helianthi (IC50: 5-10 µg/ml), Ceratocystis paradoxa (IC50: 20-50 µg/ml), Cercospora nicotianae (IC50: 5-10 µg/ml), Chalara elegans (IC50: 2-5 µg/ml), Chalara elegans (IC50: 10-20 µg/ml), Fusarium oxysporum (IC50: 10 µg/ml), Fusarium oxysporum (IC50: 20-50 µg/ml), Leptosphaeria maculans (IC50: 25 µg/ml), Sclerotinia sclerotiorum (IC50: 20-50 µg/ml), Verticillium dahliae (IC50: 5-10 µg/ml), Saccharomyces cerevisiae (IC50: 20-50 µg/ml), Phytophthora cryptogea (IC50: 5-10 µg/ml), Phytophthora cryptogea (IC50: 10-25 µg/ml), Phytophthora parasitica var. nicotianae (IC50: 10-20 µg/ml), Clavibacter michiganensis (IC50: 50 µg/ml), Ralstonia solanAngiotensin Converting Enzymearum, Escherichia coli |
| IC50 value | 5-10 µg/ml | 20-50 µg/ml | 5-10 µg/ml | 2-5 µg/ml | 10-20 µg/ml | 10 µg/ml | 20-50 µg/ml | 25 µg/ml | 20-50 µg/ml | 5-10 µg/ml | 20-50 µg/ml | 5-10 µg/ml | 10-25 µg/ml | 10-20 µg/ml | 50 µg/ml |
| Sequence | RQRDPQQQYEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEED |
| Sequence Length | 67 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 8864.62 |
| Monoisotopic Molecular Weight (Da) | 8859.07 |
| Isoelectric Point (pI) | 6.2 |
| Method / Extraction | --NA-- |