Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information | |
|---|---|
| PPepDB ID | PPepDB_2181 |
| Peptide Name | Antimicrobial protein Ace-AMP1 |
| PMID(s) | 7480341, 9521681 |
| Plant Source (Scientific Name) | Allium cepa |
| Plant Source (Common Name) | Onion |
| Plant Family | Amaryllidaceae |
| Peptide Family | Lipid-transfer protein |
| Peptide Function | Antibacterial, Antifungal, Hemolytic, Cytotoxic |
| Peptide Function Description | Target site: lipid bilayer ; Not active up to 200 µg/ml against Human erythrocytes and Human fibroblasts |
| Activity Against | Alternaria brassicicola (IC50: 2.5 µg/ml), Alternaria brassicicola (IC50: 1.5 µg/ml), Ascochyta pisi (IC50: 1 µg/ml), Ascochyta pisi (IC50: 10 µg/ml), Botrytis cinerea (IC50: 3 µg/ml), Botrytis cinerea (IC50: 7 µg/ml), Colletotrichum lindemuthianum (IC50: 1.5 µg/ml), Fusarium culmorum (IC50: 3-6 µg/ml), Fusarium culmorum (IC50: 10 µg/ml), Fusarium culmorum (IC50: 2 µg/ml), Fusarium culmorum (IC50: 1.5 µg/ml), Fusarium culmorum (IC50: 6 µg/ml), Fusarium oxysporum f. sp. pisi (IC50: 3.5 µg/ml), Fusarium oxysporum f. sp. pisi (IC50: 4 µg/ml), Fusarium oxysporum f. sp. lycopersici (IC50: 3 µg/ml), Fusarium oxysporum f. sp. lycopersici (IC50: 10 µg/ml), Nectria haematococca (IC50: 3.5 µg/ml), Nectria haematococca (IC50: 7 µg/ml), Phoma betae (IC50: 1.5 µg/ml), Phoma betae (IC50: 7 µg/ml), Pyrenophora tritici-repentis (IC50: 3 µg/ml), Pyrenophora tritici-repentis (IC50: 3.5 µg/ml), Pyricularia oryzae (IC50: 3 µg/ml), Pyricularia oryzae (IC50: 7 µg/ml), Verticillium dahliae (IC50: 0.25 µg/ml), Verticillium dahliae (IC50: 0.5 µg/ml), Bacillus megaterium (IC50: 0.8 µg/ml), Sarcina lutea (IC50: 8 µg/ml), Agrobacterium tumefaciens, Alcaligenes eutrophus, Azospirillum brasilense, Erwinia carotovora subsp. carotovora, Escherichia coli, Pseudomonas solanAngiotensin Converting Enzymearum, Pseudomonas syringae pv. Tabaci |
| IC50 value | 2.5 µg/ml | 1.5 µg/ml | 1 µg/ml | 10 µg/ml | 3 µg/ml | 7 µg/ml | 1.5 µg/ml | 3-6 µg/ml | 10 µg/ml | 2 µg/ml | 1.5 µg/ml | 6 µg/ml | 3.5 µg/ml | 4 µg/ml | 3 µg/ml | 10 µg/ml | 3.5 µg/ml | 7 µg/ml | 1.5 µg/ml | 7 µg/ml | 3 µg/ml | 3.5 µg/ml | 3 µg/ml | 7 µg/ml | 0.25 µg/ml | 0.5 µg/ml | 0.8 µg/ml | 8 µg/ml |
| Sequence | QNICPRVNRIVTPCVAYGLGRAPIAPCCRALNDLRFVNTRNLRRAACRCLVGVVNRNPGLRRNPRFQNIPRDCRNTFVRPFWWRPRIQCGRIN |
| Sequence Length | 93 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 10844.78 |
| Monoisotopic Molecular Weight (Da) | 10837.71 |
| Isoelectric Point (pI) | 11.77 |
| Method / Extraction | --NA-- |
| Secondary Information | |
|---|---|
| Tertiary Structure and DSSP Report | Click to View Structure |
| Physico-Chemical Properties of peptides | Click to View Physico-Chemical Details of PPepDB_2181 |
| External links (Uniprot, PDB and Source Information Database) | |
|---|---|
| Uniprot | Q41258, A6N9I7, A6N9J0, B2CZN8 |
| NCBI | 2497758 |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_1968, PhytAMP_PHYT00099, CAMPSQ947 |
| Addtional Information | Synthesis Type : Ribosomal |